SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234621.RER_30160 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234621.RER_30160
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Formyltransferase 1.15e-57
Family Formyltransferase 0.00000879
Further Details:      
 
Domain Number 2 Region: 208-304
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 8.95e-26
Family Post formyltransferase domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 234621.RER_30160
Sequence length 307
Comment (Rhodococcus erythropolis PR4)
Sequence
MRVVFAGTPEPAVPSLRRLIESANHEVVAVVTRPDAVAGRGRKVTRSPIGLLADEHGIPV
LTPVKASDPDFAAELARLEPDCAPVVAYGNLLPQNVLDIPKYGWVNLHFSLLPAWRGAAP
VQAAISAGDEVTGASAFRLEAGMDTGPVYGVMTERIRDTDTAGDLLGRLAENGAALLESV
LDGLEAGEINAVPQSADGVSYAPKVTVDAARVRWELPARTVDRHIRAVTPAPGAWTMIGD
LRVKVGPVTVTDETLAVGEISVRKDGLYIGTATTAVRLGQIQPPGKKLMSAGDWARGARL
DAEVRAQ
Download sequence
Identical sequences A0A0U3IEU7 A0A2A5JB81 C0ZZD9 T5HVB9 U0EHA0
WP_020907709.1.2937 WP_020907709.1.38104 WP_020907709.1.40047 WP_020907709.1.55320 WP_020907709.1.61677 WP_020907709.1.98030 234621.RER_30160 gi|226306503|ref|YP_002766463.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]