SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 234621.RER_49900 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234621.RER_49900
Domain Number 1 Region: 124-373
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-66
Family D-glucarate dehydratase-like 0.000000109
Further Details:      
 
Domain Number 2 Region: 1-135
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.19e-23
Family Enolase N-terminal domain-like 0.0000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 234621.RER_49900
Sequence length 377
Comment (Rhodococcus erythropolis PR4)
Sequence
MHIESVELRELRIPLVSPFTTSFSTQLERNTLVLKVSGTTDGPNGPVETVGWGECGSLSD
PYYNSEYTAGARAMLREYLVPTLRKSQSDQPLSAETVGSVLHHIVGHQMSKSAIEMAILD
AELRARGQSFARYLGATRTRVPSGVSVGIQDSIPQLLETVGNYLSQGYVRIKLKIKPGWD
IAPVAAVRKEFGYDVPLQVDANAAYTLVDAQLLRRLDEFALLLIEQPLAEDDLVQHAKLA
QSLSTPICLDESVESAKDAADAITLGAASVINIKPSRVGGYLEAKRIHDLASAHGIAVWC
GGMLETGIGRAANAALAALDGFTLPGDISASDRFYKEDITEPFVIEDGHIAVPQGPGFGV
TPREDVMDRFTVGTETL
Download sequence
Identical sequences A0A1F2PVA1 C0ZPK2
gi|226308477|ref|YP_002768437.1| WP_020909062.1.17328 WP_020909062.1.2937 WP_020909062.1.3298 WP_020909062.1.40047 WP_020909062.1.77150 WP_020909062.1.81178 234621.RER_49900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]