SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 235279.HH1567 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235279.HH1567
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.28e-35
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 235279.HH1567
Sequence length 185
Comment (Helicobacter hepaticus)
Sequence
MMHQLRFTGVGGQGVLLAGEILAEAQIKDKGYGVKAATYTSQVRGGPTKVDILLSNEEIL
YPYANEGEIEFMLSTAQVSYDSFKNGVKEGGVIVVEPNLVRPSQEDFKRFKIYEIPIITI
AKEEVGNVVTQSVVALAITTTFTQCVDRNLVFQTMIEKVPAKVQEANKKAFELGEKYAKE
AKVSS
Download sequence
Identical sequences A0A099BT47 Q7VFV8
gi|32267066|ref|NP_861098.1| 235279.HH1567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]