SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 235279.HH1691 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235279.HH1691
Domain Number 1 Region: 90-284
Classification Level Classification E-value
Superfamily Formyltransferase 1.18e-54
Family Formyltransferase 0.00022
Further Details:      
 
Domain Number 2 Region: 11-65
Classification Level Classification E-value
Superfamily ACT-like 0.0000000121
Family SP0238-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 235279.HH1691
Sequence length 284
Comment (Helicobacter hepaticus)
Sequence
MNTLNAPHTQRIILISAPDKKGLIYHISSVLYDLGLNIERNDEYVDRENERFFMRTHICG
ETDDDLLNTKLQTILPPDSTLKIQPVCKKNIIILCTKENHCVGDLLLKYDSGELNAHIQA
IISNYETLKPLADKFYIPFFYIPAENQSRKAHETQLLKVISHFDSAYLVLAKYMRILTSD
FTQHFENKIINIHHSFLPAFIGANPYKQAYERGVKLIGATAHFVNENLDEGPIITQDIIH
INHSHSWQDMQKAGRDIEKVVLSRALNLALEDRIFVYGNKTIIF
Download sequence
Identical sequences Q7VFI5
WP_011116530.1.84735 gi|32267190|ref|NP_861222.1| 235279.HH1691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]