SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 235909.GK0086 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235909.GK0086
Domain Number 1 Region: 9-131
Classification Level Classification E-value
Superfamily RNase III domain-like 9.77e-44
Family RNase III catalytic domain-like 0.00000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 235909.GK0086
Sequence length 140
Comment (Geobacillus kaustophilus HTA426)
Sequence
MAEFETVNDVKQLNGLALAYIGDAVYEVYVRRHLLAGGSVRPHELHRRAVRYVSARAQAR
VILALLDEGVLTEEEKDIVRRGRNAKSGTIPKNTDVQTYRHSTAFEALIGYHFLVNNEKR
VDELIGRSFAIIEREERALE
Download sequence
Identical sequences A0A0K2H945 Q5L428
gi|56418621|ref|YP_145939.1| 235909.GK0086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]