SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 235909.GK3422 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235909.GK3422
Domain Number 1 Region: 11-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.08e-22
Family Anti-sigma factor antagonist SpoIIaa 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 235909.GK3422
Sequence length 116
Comment (Geobacillus kaustophilus HTA426)
Sequence
MDQKQFRLVHDEQPDRHVVYIKGELDLAAAEQFQRTVEPLAGDASKPLVLRLEDLTYIDS
TGIGMFVALLKTRHQLGAPFAIENVPPKVRRLFDLTGVSYFFSEMNDASERIGGQS
Download sequence
Identical sequences A0A161YWC3 A0A1V9C4C3 A0A223DWJ4 Q5KUC9
WP_011232889.1.14676 WP_011232889.1.20723 WP_011232889.1.2219 WP_011232889.1.26402 WP_011232889.1.38928 WP_011232889.1.62042 gi|56421957|ref|YP_149275.1| 235909.GK3422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]