SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 237895.Q5CGP4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  237895.Q5CGP4
Domain Number - Region: 31-47
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0977
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 237895.Q5CGP4
Sequence length 277
Comment (Cryptosporidium hominis)
Sequence
MERENIFTERNLIENLFSFSKRKKFDIQINNSKLCICLNCNQTGHVNCGRQAPMFSKGSK
IKDMISSTESKFLIFPEDSNSISQINRNQYLKTNIIIPSNKLFNISYLLEFTKSSLNQTN
IKDKVVEIEQESRPIFTSRNNNFSQINNRPYPQNQIQFHHPNQFNIHNHNVLQQQIPNQA
YSYHNHNLQYQHFQNNLQLHAHLFQQDPIYRNPNQLLQGQQYNYDRLVSNQINAGFASNQ
NNTVYSRSAVQTNRTTTTSNAKRKVFNCGSNFRGRRK
Download sequence
Identical sequences Chro.50165 gi|67595497|ref|XP_666002.1| 237895.Q5CGP4 XP_666002.1.74355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]