SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 237895.Q5CH77 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  237895.Q5CH77
Domain Number 1 Region: 10-111
Classification Level Classification E-value
Superfamily Histone-fold 7.54e-46
Family Nucleosome core histones 0.0000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 237895.Q5CH77
Sequence length 115
Comment (Cryptosporidium hominis)
Sequence
MAPKMSSKNNKGAAPKKIHKKKKESYSTYIYKVLKQVHPETGISKKSMMIMNSYISDTFE
KIAQQAAQLCQTTKKDTIASREIQTAVRLVLPGELAKHAVSEGTKAVTKFTGGQK
Download sequence
Identical sequences A0A0S4TFX1
237895.Q5CH77 gi|67597992|ref|XP_666188.1| Chro.50055 XP_666188.1.74355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]