SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 237895.Q5CI97 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  237895.Q5CI97
Domain Number 1 Region: 44-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.45e-40
Family Tandem AAA-ATPase domain 0.0013
Further Details:      
 
Weak hits

Sequence:  237895.Q5CI97
Domain Number - Region: 204-226
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0034
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 237895.Q5CI97
Sequence length 251
Comment (Cryptosporidium hominis)
Sequence
MPRKTQEFAQTALIDPVVVNVGRAGAANLRVIQEFEYIRQERRLVSLLSCLQKTAPRVLI
FSENKKDVDEIHEYLLLKGVNAVAIHGGLTQEQRFRSIEQFRNGEMDVLVGTDVASKGLD
FENIQHVINFDMPKDIENYVHRIGRTGRGGSVGVSTTFIDNTLPEALLCDLKALLIEAKQ
EIPPFLEQFDSTNTSLQEIGGVRGCAYCGGLGHRIGQCTKLLELQRKTQSGAPKDALSLG
ARYTSSNKEDW
Download sequence
Identical sequences Chro.70507 237895.Q5CI97 XP_666549.1.74355 gi|67603410|ref|XP_666549.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]