SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 237895.Q5CKI5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  237895.Q5CKI5
Domain Number 1 Region: 1848-1954
Classification Level Classification E-value
Superfamily Bromodomain 1.96e-26
Family Bromodomain 0.00057
Further Details:      
 
Weak hits

Sequence:  237895.Q5CKI5
Domain Number - Region: 1603-1635
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00314
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 237895.Q5CKI5
Sequence length 1966
Comment (Cryptosporidium hominis)
Sequence
MKTNSFHSEEGFFGFLGQMNKSFVGELCLEELTESEESEIGDTEVIKNEDVLELRELETL
RSIPVSIKLPSDINNDGSEDELVCKKENKARTEVAPGSNIKVNRGRGGSSNLNGISLETI
DTDVENDSIKVEISEKLLEPMSRIRSDNTQEGGIFWGEKDEKDENYEAMGSIDSGYSIFG
ISRPFTSNLLKVTMEDGDSDNDSEDELEYFQMSDSEKSMFKVRSKIKGDYFLDEISNKIS
IFSSDENSAQDKSTEFFIHIDTKDPGFSKNLGGISKELKEKLGLDNSSKHNLGVDLLGIT
GSITRNQEVNTIGLGGKEQDHSRGEAQQSSSGGGSGNNCNTGGSSSSKPLSKAQQERQRR
QKMKKIDKQKRLELAILGMNPLDYEGGIRNPDKVLDENQDLVDMKDGEDGKVGESSGGGS
LSYNSGIAALASSILMSNMPQKDRIFGLKLREMSLDDSCLFSIRQFLHLVPRLFDGKSYD
EIDDLFEEIRTSVASSGSKNEKQRSKQTLKSRNEWQNLLIKWLTYVFKFSERNGISMYES
WAESNRQYHESRVLLNSLGSGYGEGGGANGGDQIGGGNSLPPISSLHTPLAWSFYLVSGN
MLPIDGVRFHKSDFRMGIFESFSSRTNLIYTYSSNWFASLVNSKSAKSESGFEPFGPWLV
TPLFLGAKGGGGSQGHSSTPQLLHRYFQRQREFKDIPSSINSSICFVSPDDLSLIHQTPV
ALFEYLEQYPLLLNNLGMAARIHRYVRCEDDSNRKQIEDLLSECGPLGFVQKVQEDTKTG
GSSTSSQSGTFPKFFGVNYPLEENESMAVLETGLFKAPIYHHPRRQRNLQAGENTNMEDG
GEASFIKDDEDEEERDRSGKGKFSAYFLLIRKQIQQGSSKCGLYLRPLSGDCLTCLYSVG
QEEPLVEVPCVDSKSFSNLRRDHLKALVLRYAKENGKDTFSEVRKLSQKMFRNTFDQNTL
QKILMSCKETKESSGSDSISGIGVGGSSVAGGPSLSSNGSHSSLLGGIGGGVVVGTGIGG
SSSQSSIQVGVGGGSGGGGVLIKQLNESELRQIINPESLCALDSSVSGDMRLKQIGVRSL
RHFSKIPIVVSELDQMEEIAKQYAEQARKRTNSLIEKAKEAETWSKDSSMGKSCKYSSLL
SLINEVSTGLINSNGRRLTPVARYIEESLLLSPWNITQEYGQVMRHQNGQFSIAGIGDPS
GGRGEGVNFIRRGLIDSAIESRSQKALAGKSEDLRKLSMDQLRQRLLQCGLDDVAIIPLP
RWDRVALVRHFDTSGGNSNGKSGSGSSSNSMLQNKALSSEEYQRAIVNVLVNQKNALSPD
DPIMTDDEEEEEERRGDGRDDELRVEDEGEVEMELDILSENTPNKSETEGSRGELKPSQD
VDMLESMLIDSYNSRSDLVVSQEDSSPNRDSDESGSDLDEDLDLEESFISSLVKSNDNNN
ESNERISGKYEGDNGNYDNSNLTSGDYSNSKVKHMKQSKLYDQLYGNSNDDTGRDEEDEK
DLEEFRRMISKSTPQDGIDQELDGNGMDWRNQNSQEDSSSSGQEYVPRIAWIRVRRNMNT
WQYEDEKVVYIYGEENIRYFLYWRRMRMQLKREERRQLNPTGVPGVLGRASRTCRRCGQV
GHIASNPMCPYYEGNKSSSGTSRYQNAISQSRKKNMLLPKGFEIGGGIASCKLSASEEES
TIANLLGMGYSQTNNCDIKQLVTLDNVVHSVRVGKRGRPPSNPTSNSRGDTGLSSSSIRN
TQLSSSSLGNFEDSTETQTNTQANVGTGSSVQFSRLSARQRRKMMDNDDKSSVVSFTSTA
LNGGSQTCNFNNALNPSSGGAGLHISNNLDGSHNVINAGPNITSYTEALDEFCIELQRII
NSTKTLHHYSHVFWNRVSERIAPNYYNLVKRPMWLQLMINKCKKREYKSRKDFQDDLDLI
VENCKIYNGINHPLVSVATLIHSNVVKKIDEIQGIEKIEAYLSLKP
Download sequence
Identical sequences gi|67614062|ref|XP_667345.1| Chro.40082 XP_667345.1.74355 237895.Q5CKI5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]