SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 237895.Q5CKN4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  237895.Q5CKN4
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.17e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 2 Region: 76-128
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.38e-16
Family Ribosomal protein L40e 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 237895.Q5CKN4
Sequence length 128
Comment (Cryptosporidium hominis)
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGVIEPSLANLARQYNCEKMICRKCYARLPPRATNCRKRKCGRTSQ
IRPKKKLK
Download sequence
Identical sequences A0A0S4TIM0 F0X6C0
Chro.70260 XP_667394.1.74355 gi|67614873|ref|XP_667394.1| 237895.Q5CKN4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]