SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 237895.Q5CM44 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  237895.Q5CM44
Domain Number 1 Region: 385-467
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000114
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 2 Region: 290-317
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000733
Family Retrovirus zinc finger-like domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 237895.Q5CM44
Sequence length 476
Comment (Cryptosporidium hominis)
Sequence
MANNKIYYKFKSEKKFKDLTHEFPALVSHVRSKLREILDIGEDMDILATQSDKNGRVSNV
YLSDYEILKEGIYLNVVRLPKDLAKPLLEAANSKIKNKPSTASQATNSASSGTAPSNTSS
MREQTILSPPSTTDLAPNSGNFTKVGESKDDDHNSVLNSTNPSNNSKNNSSEDAAILLVM
QQHGEKFKQTAAQRSEMLEQFNQRGYPKSVTSTGSRYGAGNTTGTNFSASSQFRSEPYKK
LGAIGTGPLNTGSSNNYFGGQSYNANFGPSSVSVNYNYKNAMANTSTDVPADYICHMCGE
RGHHIRVCPKVNEGVSQKKIRPATGIPRSFLRAINFDEEGRLYSEVYCLPDGTFAVLKDA
KQLSSTAFLTRTVEDTIGKHMGKSKEDTSLVRDSLTCPICARLFRYAVLTPCCGETYCQE
CIINFIRNHMDAASGISPNTIKGYCPHCSTVISIADLEPNNPIRKSVNVALGLQPI
Download sequence
Identical sequences A0A0S4TMD3
XP_667905.1.74355 gi|67623245|ref|XP_667905.1| Chro.80429 237895.Q5CM44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]