SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 240015.ACP_0173 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240015.ACP_0173
Domain Number 1 Region: 115-364
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.45e-57
Family D-glucarate dehydratase-like 0.00000329
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.25e-34
Family Enolase N-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 240015.ACP_0173
Sequence length 373
Comment (Acidobacterium capsulatum ATCC 51196)
Sequence
MKIDSITLREVRMPLVKPFETSFGKTTNRRILLVELKAEGYTGWGECVAGEHPFFSDETI
DTAWLVISQELAPALAAADPEHGGKCHQIFGNVRGHRMAKAALENAVWDAEAQMKEIPLS
VLLGGVRETIPCGVSIGIQPTLEDLMREIEQSLAAGYQRIKLKCKPGWDVKVFEAVRNRW
PDILLSCDANSAYRLRDSDHIASFDQFRLLMIEQPLWSDDFYFHSMLQKRLETPICLDES
IRNRRDALAAIDMESCQIINIKNGRVGGFSEAIAVHNVAQERGIPVWCGGMLETGIGRAH
NIALSSLENFTLPGDVSASSRYWAEDIIEPAVTVNAQGEIAVPDVAGRGYEVRADLIEQL
TVRKEEIRALALA
Download sequence
Identical sequences C1F8P4
240015.ACP_0173 WP_012680576.1.62785 gi|225871864|ref|YP_002753318.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]