SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 240015.ACP_3368 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240015.ACP_3368
Domain Number 1 Region: 14-194
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.29e-22
Family Clp protease, ClpP subunit 0.084
Further Details:      
 
Domain Number 2 Region: 368-432
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000209
Family NfeD domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 240015.ACP_3368
Sequence length 439
Comment (Acidobacterium capsulatum ATCC 51196)
Sequence
MTFPRERRFRLLLALWFLAFSCLALGAQSKAPQVYVLHLDDTIQPISADYLARGIHEASR
AHAEALLVEMNTPGGLLASTRVMVHDILSSPVPVIFYIAPTGSRAGSAGFFLLEAADVAA
MAPGTEAGASHPILEGRSMGATLKEKITNDAMAFLRSYVAPRGRNVDAAQEAVLHSKSYT
PQEALSLHLIDLIEPSTPALLEALNGRAITRFNGQQVVLHTAGAQLVDVTPSFRERVFDP
LMDPNVAVLILITGALLIYLEFHIPGTIVPGALGTLLVVIALFALNMLPVHDASWLLILA
AFVLILLEAKFPSHGILAGLGTVLLVVGLLTLVNGPIPQLRVQLATALAAGLGFGIITTI
LVRAAWRARHNKIMTGPAAMLGAIGIAQEELAPRGQVLVRGELWFAEAAEPIPAGAHVKV
TGLRGLTLQVESLSEATAT
Download sequence
Identical sequences C1F6D6
gi|225874906|ref|YP_002756365.1| 240015.ACP_3368 WP_015898399.1.62785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]