SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_0403 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  240292.Ava_0403
Domain Number - Region: 89-136
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000131
Family NfeD domain-like 0.0083
Further Details:      
 
Domain Number - Region: 20-95
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.000955
Family ABC transporter transmembrane region 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_0403
Sequence length 143
Comment (Anabaena variabilis ATCC 29413)
Sequence
MPISTLIWLLAGAVLCLTELFLPSAFIAFMMGISALMVALLSQLGLALWLQVVAWLFLST
VLIVLSRRFLQPRQRKSKIQDAITAETLTEILPGQAGRVLYEGNSWRAKCDDEQITIAPH
QRVYVVRREGTTLVVMPENLLHF
Download sequence
Identical sequences A0A1W5CFK3 Q3MG57
240292.Ava_0403 gi|75906628|ref|YP_320924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]