SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_1567 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_1567
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.04e-25
Family Anti-sigma factor antagonist SpoIIaa 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_1567
Sequence length 112
Comment (Anabaena variabilis ATCC 29413)
Sequence
MNTNFQVIELSGILDGIRGNQLRREISELIADGNNIFLLDMNAVTFMDSSGLGSLVSAMQ
MLRSVNSQLFICSMNDQVKMLFELTKMNRIFQTFIDQDDFKRQILTATRAIS
Download sequence
Identical sequences A0A1W5CEU4 Q3MCU6
240292.Ava_1567 gi|75907789|ref|YP_322085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]