SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_2772 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_2772
Domain Number 1 Region: 25-114
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.35e-24
Family Pentapeptide repeats 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_2772
Sequence length 129
Comment (Anabaena variabilis ATCC 29413)
Sequence
MSEVNYQQPISTVATLIEMYTAGRRDFNRAELGDANLQNVDIKGSDLSYADLSTANLRGA
NLRGTDLSFADLSQADLQDADLRGALLMSANLRQANLQGAKLEKADCDRNTHFPENFDLL
KAGLQLKEQ
Download sequence
Identical sequences A0A1W5CQK9 A0A1Z4KPF0 Q3M9F1 Q8YLT7
2005146106 gi|75908984|ref|YP_323280.1| 103690.alr5209 240292.Ava_2772 gi|17232701|ref|NP_489249.1| WP_010999333.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]