SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 242231.NGO1886 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  242231.NGO1886
Domain Number - Region: 10-80
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0534
Family BAR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 242231.NGO1886
Sequence length 140
Comment (Neisseria gonorrhoeae FA 1090)
Sequence
MAGCLTDLENCLEKYLEQFGPVSESIEACTAKLQEQPSFFNRLMKANDKLNRQIDVLQKQ
SAAIHNEAYIEMNTLLYRHREVVSIHNRKADYAEKGKERIALFPRGLNGITKLPAAVLLP
ERPYHFDMKEVLYIFSRIPR
Download sequence
Identical sequences A0A0M3GZD0 A0A1D3IRV3 B4RPV1 Q5F5N4
242231.NGO1886 521006.NGK_2374 gi|59802203|ref|YP_208915.1| gi|194099862|ref|YP_002002999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]