SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243090.RB10326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  243090.RB10326
Domain Number - Region: 509-569
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000922
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243090.RB10326
Sequence length 588
Comment (Pirellula sp)
Sequence
MPAIECVGLCNGRGFHSIRDADFMMNAPSDSSTASMDTPPRGDISGFKRFLKDDLIAGGL
VFLIALPLCLGISLASGFPAIAGVFTAIVGSILTTFLSNSELTIKGPAAGMIVIVLGAVN
SFGYTAGVDPVADMQAYKMALAVGVVAGLVQIAFGLLRAGILGDFFPTAAVHGMLAAIGV
IIMVKQLPIVVGQSASGEPLEILQELPHLLMNANPEIALIGGVSLLILFGLAFLKSRTSD
GFINKIPGPLVVLLVAIPMGMAMNLSSDHTYTLMGKEFTVGESDLVTVPFNLFGAITFPD
FGVFLNSETLPAALGWVLMFALIGSLESLLSAKAVDMLDPHKRKTNLDRDLWAVGVGNMA
ASLIGGLPMISEIVRSKANIDNQAKTRFANMWHGVFLLGFVALLPGLIHNIPRAALAAML
VFTGFRLASPSEFRSVYRVGREQLIIFATTLVAVLATDLLIGIAIGIATKFAIHMINGVP
LRSLFVPTLQFDETSETEVNVHAGDSAVFSNWIGFRRQVVEKSLKQGKNCTVDFSDVHLI
DHSVMEKLHELEGEFAREGIELNVVGMDHHQPFSRHPMAARKRSFVSH
Download sequence
Identical sequences Q7UF60
gi|32476372|ref|NP_869366.1| 243090.RB10326 NP_869366.1.48053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]