SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243090.RB10665 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  243090.RB10665
Domain Number - Region: 15-57
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0131
Family NfeD domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243090.RB10665
Sequence length 200
Comment (Pirellula sp)
Sequence
MAGELGTTTSCQTARLNVMITHHVRIGFAGEIYLARAERRIERGRRVLVRTPRGVELAEV
LSVCDDDGTPTTLEILRPTTHNDDLLIERLQRHKVRAVRECQAILAESESSAVLLDVDQL
FDGGTLVLHFLGEPDALGRELTDAIVRRYESEVKSIELSDLMQTGCGPGCGTADAGGCGG
GCSSCSGCGIASARQKQPLG
Download sequence
Identical sequences Q7UKG0
243090.RB10665 gi|32476549|ref|NP_869543.1| NP_869543.1.48053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]