SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243090.RB12506 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB12506
Domain Number 1 Region: 45-133
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.85e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0037
Further Details:      
 
Weak hits

Sequence:  243090.RB12506
Domain Number - Region: 5-25
Classification Level Classification E-value
Superfamily Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain 0.0628
Family Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243090.RB12506
Sequence length 145
Comment (Pirellula sp)
Sequence
MGGNRCPNASCISSCRSEQTHMSAITEQMQGEVLIVGFTDNALRDAQRIEVVGREMQEIV
PQAIHKKMLIDFSGLAFMSSAMINKLILLNKSCKAQGVALKFCNVSPLVMEVFRIVNLGK
LIDIQGDQEVAVASFDKKGWFGGKK
Download sequence
Identical sequences Q7UII6
243090.RB12506 NP_870551.1.48053 gi|32477557|ref|NP_870551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]