SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243159.AFE_1800 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243159.AFE_1800
Domain Number 1 Region: 9-111
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.07e-36
Family Enolase 0.0000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243159.AFE_1800
Sequence length 116
Comment (Acidithiobacillus ferrooxidans ATCC 23270)
Sequence
MDSRIQDLTARAMEDNIANATLIKLHQIGTVTETITATRLAQFHGWDAFVSHRSGETPDD
FIADLTVALDTGHLKSGAPARGERVANHDQLLRIKEELGATASFAGKHAFRRLVRF
Download sequence
Identical sequences B7JBQ6
gi|218666911|ref|YP_002426218.1| 243159.AFE_1800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]