SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243160.BMAA2031 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243160.BMAA2031
Domain Number 1 Region: 485-595
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000161
Family Anti-sigma factor antagonist SpoIIaa 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243160.BMAA2031
Sequence length 610
Comment (Burkholderia mallei ATCC 23344)
Sequence
MTERERAARGRNDARRGGGDSGGDDEAWRRWLPGIATLRTYRRAWLARDLYAGVALTAVL
VPVGMSYAQAAGLPVIAGLNASIAALVGYAIFGPSRILVLGPDSALAALIAGAIAPLAHG
EPAHAVALAAALALMSGGFCVLAGLLKLGFVTDLLSKPIQYGYLNGLALTLIASQLPSLL
GTVPLGGTFVDQVASLAATVAQGRIDFASLALGGGCLAGIALLRRVAPAWPGMLIAVAGA
SIVAAWLGAAPDAGGAHAHVAYAHVANAHVALVGSLAGTLPPLGLPSISLADASRLIAGA
LAIAMVSVADISVLSHVFAQHDGSETDRNQELCALGAANLLAGMLRGCAVSSSASRTPVA
LAAGARTQLTSLVAAACIALLLIAPTLLARVPLAALAAVVVYSANALVDVRAIVRLYRVR
RGECAVSVLCFAGVVLLGVVPGILLAVGLSLLSFVWRAWHPYDAVLGRVEGMHGYHDVSR
HPGATLTRGLVAFRWDAPLFHANATIFRDHVRDAIAEAGAPVRCVVIAAEPITDVDVTAA
DMLATLRDELAARRIALVFAEMKGPVKDRLRTYGLFEKIGADHFFPTVTDAIEHFTRMRK
DVATARRARR
Download sequence
Identical sequences A0A0H2WAG1 A0A290YES6 A2RZM3 C4AV19
gi|126445899|ref|YP_001079492.1| gi|53715931|ref|YP_106546.1| gi|121597979|ref|YP_990654.1| gi|124381335|ref|YP_001025143.1| 243160.BMAA2031 320388.BMASAVP1_1055 320389.BMA10247_A2321 412022.BMA10229_1341 WP_004187792.1.100104 WP_004187792.1.100727 WP_004187792.1.13925 WP_004187792.1.20531 WP_004187792.1.21442 WP_004187792.1.22329 WP_004187792.1.22625 WP_004187792.1.23385 WP_004187792.1.26445 WP_004187792.1.28453 WP_004187792.1.29148 WP_004187792.1.31831 WP_004187792.1.3251 WP_004187792.1.33543 WP_004187792.1.34747 WP_004187792.1.35757 WP_004187792.1.35878 WP_004187792.1.38946 WP_004187792.1.39349 WP_004187792.1.43899 WP_004187792.1.44540 WP_004187792.1.4810 WP_004187792.1.48313 WP_004187792.1.48407 WP_004187792.1.53977 WP_004187792.1.54892 WP_004187792.1.57679 WP_004187792.1.61073 WP_004187792.1.61588 WP_004187792.1.66594 WP_004187792.1.67393 WP_004187792.1.69508 WP_004187792.1.72545 WP_004187792.1.72798 WP_004187792.1.74675 WP_004187792.1.75230 WP_004187792.1.75861 WP_004187792.1.78557 WP_004187792.1.79653 WP_004187792.1.82283 WP_004187792.1.84480 WP_004187792.1.9236 WP_004187792.1.9281 WP_004187792.1.95952 WP_004187792.1.96660 WP_004187792.1.98066 YP_106546.1.87047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]