SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243164.DET0593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243164.DET0593
Domain Number 1 Region: 140-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.35e-130
Family Enolase 0.0000000321
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.28e-54
Family Enolase N-terminal domain-like 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243164.DET0593
Sequence length 428
Comment (Dehalococcoides ethenogenes 195)
Sequence
MSAVVKSIKAREILDSRGNPTVEADVVLSDGSFGRAAVPSGASTGSHEAVELRDGDKSRY
NGLGVQKAVTNVNTAIAKAISGFKASDQQGLDNLLIELDGTPNKAKLGANAMLATSLAVA
HAAAASCHMPLYRYLNNCDEYILPVPMFNILNGGKHASNSTDFQEFMVMPTGAKSFAEAL
RMGTEVYHSLKKVLKGMNQNTTVGDEGGFAPSLPTNKDAVEVILKAIEKAGYRPGEDIFI
ALDPASSELYQDGKYTLATENKTLSSAEMVDYWCGWVEKYPIISIEDGLFEDDWDGWKML
TKKIGSKVQLVGDDFYVTNIKRLERGIKENASNSILIKLNQIGTLSETIAAIKMANNSAW
TAVVSHRSGETEDTTIADLAVAMNAGQIKTGAPCRAERTAKYNRLLRIEEELGGKAKYPG
KEAFFNLK
Download sequence
Identical sequences Q3Z8W4
WP_010936368.1.69666 243164.DET0593 gi|57234609|ref|YP_181335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]