SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243230.DR_0044 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243230.DR_0044
Domain Number 1 Region: 120-366
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.49e-68
Family D-glucarate dehydratase-like 0.00000000232
Further Details:      
 
Domain Number 2 Region: 6-132
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.31e-28
Family Enolase N-terminal domain-like 0.000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243230.DR_0044
Sequence length 375
Comment (Deinococcus radiodurans)
Sequence
MAHTGRMFKIEAAEIVVARLPLKFRFETSFGVQTHKVVPLLILHGEGVQGVAEGTMEARP
MYREETIAGALDLLRGTFLPAILGQTFANPEAVADALGSYRGNRMARAMVEMAAWDLWAR
TLGVPLGTLLGGHKEQVEVGVSLGIQAGEQATVDLVRKHVEQGYRRIKLKIKPGWDVQPV
RATREAFPDIRLTVDANSAYTLADAGRLRQLDEYDLTYIEQPLAWDDLVDHAELARRIRT
PLCLDESVASAADARKALALGAGGVINLKVARVGGHAESRRVHDVAQSFGAPVWCGGMLE
SGIGRAHNIHLSTLPNFRLPGDTSSASRYWERDLIQEPLEAVDGLMPVPQGPGTGVTLDR
EFLATVTEAQEEHRA
Download sequence
Identical sequences Q9RYA6
243230.DR_0044 gi|15805085|ref|NP_293770.1| NP_293770.1.55610 WP_010886692.1.45201 WP_010886692.1.61927 WP_010886692.1.86829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]