SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243230.DR_A0368 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243230.DR_A0368
Domain Number 1 Region: 106-394
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.00000000000012
Family Glycosyl transferases group 1 0.036
Further Details:      
 
Weak hits

Sequence:  243230.DR_A0368
Domain Number - Region: 55-95
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.00751
Family D-glucarate dehydratase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243230.DR_A0368
Sequence length 415
Comment (Deinococcus radiodurans)
Sequence
MSHALRPLCPPPEQFRPHDGRRPVVVASCSTQAPALLVLSHLRWNFVFQRPQHLMTRAAR
TRRVFFIEEPVFGEDADRLEMVTDASGVTVCTPHVESGHSPAESQARTARLLTQLVQSEG
LDTYDLWVYTPMELPVAAGLTPRLTVYDCMDELANFRGAPPELREREQQLFEQAGVVFTG
GHRLYEAKCLQHGNVYPFPSSVEVEHFAQARQDLADPADQRELPRPRLGFYGVIDERFDT
ALIGELARRRPEWQIVLLGPVVKIDPAELPQAPNLHYLGQKTYAELPQYLAHWDVALLPF
ALNPSTEFISPTKTPEYLAAGVPVVSTGIRDVIRPYGEGEMVRVADGVDAFEAACAAALD
EAGTAQATERQQRADAYLAGLSWDRTWNEMQAAMESAVQTQQSAAPAPLRESADD
Download sequence
Identical sequences Q9RYF0
NP_285691.1.55610 WP_010889627.1.45201 WP_010889627.1.61927 WP_010889627.1.86829 243230.DR_A0368 gi|15808026|ref|NP_285691.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]