SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243231.GSU0872 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  243231.GSU0872
Domain Number - Region: 79-123
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0144
Family NfeD domain-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243231.GSU0872
Sequence length 155
Comment (Geobacter sulfurreducens)
Sequence
MKRSVLVALAVVSLAAAGCKDKPKAPETAAPAPQEQSGMPAGMPAGMPPAPQGEMPKDAV
HGGGDPHAGLKPVEVPAGVGHKGKVLSTMDAAGYTYLEVEEKGQKLWVAVMQTKVKVGDQ
VEFPDSPPMLNFHSKTLNRTFEKIIFAPGIRIGGK
Download sequence
Identical sequences A0A0D5N9R7 Q74ET7
gi|409911423|ref|YP_006889888.1| gi|39995978|ref|NP_951929.1| 243231.GSU0872 NP_951929.1.89865 WP_010941536.1.53615 WP_010941536.1.88929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]