SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243231.GSU2431 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243231.GSU2431
Domain Number 1 Region: 16-194
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.58e-28
Family Clp protease, ClpP subunit 0.075
Further Details:      
 
Domain Number 2 Region: 365-432
Classification Level Classification E-value
Superfamily NfeD domain-like 1.96e-22
Family NfeD domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243231.GSU2431
Sequence length 433
Comment (Geobacter sulfurreducens)
Sequence
MGGSRRGIRIGALIAWCLMICTGAALLASTGGDVRVVGLRGAVNPVTASFLKRNLDDAAR
KGDRLVLVEMDTPGGLDTAMREIVKDILASPVPVAVYVAPAGARAASAGAIITLAADIAA
MAPGTNIGAAHPVAIGEKQDKVMEQKVLNDAEAYVDGIASRRGRNAEVARRMVRESLSLP
AEKALEEKMIDLIAADRSALFAQLEGRPVSRPGGDTVLRLAGAPVREAEMTTRERILDAI
GNPNVAYVLMMLGFLGLFFELSNPGVILPGVIGGIALILAFFAFQTLPVNYAGVLLILLA
LILFIAEIKVVSGGMLTVGGVIAMVLGSILLFESPEPYLRVSWQVIAVTVAAVSAFSIFA
VTMAVRAHRRKPTTGGEGLVGETGKALSPIAPEGRVFIHGEYWDAWSDEPLAEGDRVMVV
AVDGMRVKVKKLS
Download sequence
Identical sequences 243231.GSU2431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]