SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243232.MJ0225 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  243232.MJ0225
Domain Number - Region: 42-68
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0262
Family NfeD domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243232.MJ0225
Sequence length 263
Comment (Methanococcus jannaschii)
Sequence
MMRLEKVFYLTNPTTKDLENFIDMYVFKYILILLARCKVFYEGRAKSQLEEGDRVIIIKP
DGAFLIHKDKKREPVNWQPSGSSIIWEVEDNFFILKSIRRKPKEELKVVISEVYHACAFN
CEDYEEINLRGSESEMAEMIFRNPDLIEEGFKPISREYQIPTGIVDILGKDKENKWVILE
LKRRRADLQAVSQLKRYVEYFKNKYGEDKVRGILVSPSLTTGAEKLLKEENLEFKRLNPP
KGSKRDLKHNIKTKKTTVLDEWL
Download sequence
Identical sequences Q57678
gi|15668398|ref|NP_247194.1| 243232.MJ0225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]