SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243232.MJ0232 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243232.MJ0232
Domain Number 1 Region: 147-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.45e-196
Family Enolase 0.000000655
Further Details:      
 
Domain Number 2 Region: 11-144
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.74e-95
Family Enolase N-terminal domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243232.MJ0232
Sequence length 427
Comment (Methanococcus jannaschii)
Sequence
MLYNMDERFEIKDIVAREVIDSRGNPTVEVEVITKGNGYGSAIVPSGASTGTHEALELRD
KEKRFGGKGVLMAVENVNSIIRPEILGYDARMQREIDTIMIELDGTPNKSRLGANAILAV
SLAVAKAAAATAKIPLYKYLGGFNSYVMPVPMMNVINGGKHAGNDLDLQEFMIMPVGATS
ISEAVRMGSEVYHVLKNVILEKYGKNAVNVGDEGGFAPPLKTSREALDLLTESVKKAGYE
DEVVFALDAAASEFYKDGYYYVEGKKLTREELLDYYKALVDEYPIVSIEDPFHEEDFEGF
AMITKELDIQIVGDDLFVTNVERLRKGIEMKAANALLLKVNQIGTLSEAVDAAQLAFRNG
YGVVVSHRSGETEDTTIADLSVALNSGQIKTGAPARGERTAKYNQLIRIEQELGLSKYAG
RNFRCPF
Download sequence
Identical sequences mja001000232.1 243232.MJ0232 gi|15668407|ref|NP_247203.1| 2pa6_A 2pa6_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]