SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243232.MJ0558 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243232.MJ0558
Domain Number 1 Region: 5-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000277
Family CAP C-terminal domain-like 0.051
Further Details:      
 
Weak hits

Sequence:  243232.MJ0558
Domain Number - Region: 91-119
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00811
Family NfeD domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243232.MJ0558
Sequence length 261
Comment (Methanococcus jannaschii)
Sequence
MKKRNITEFQVLSEIIRKQPHIKQKEIAENLGITVQAVSEHIRNLVKEGYVKSRGRGEYV
VTEKGLRKLKNWISEFKDYLDEINTAVYRYKDIWPAIADEDVKDGETVYLFMKNGLLYAS
KQPKGEAKAKALYGGKKGEDIAICEIKGIIDVPKGKVIVFRIPPEVVGGSRAVDFNLIKE
NIDNLDDYVIATMGTVAYVVACKLGLKPDIRFAVPEAIVNACNRGCNVIALITGKMAEKV
IKKLDNAKISYTVLDATKENK
Download sequence
Identical sequences Q57978
243232.MJ0558 gi|15668738|ref|NP_247537.1| WP_010870062.1.84152 379508 APC88960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]