SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243232.MJ1650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  243232.MJ1650
Domain Number - Region: 21-71
Classification Level Classification E-value
Superfamily FdhE-like 0.000484
Family FdhE-like 0.023
Further Details:      
 
Domain Number - Region: 144-174
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 0.012
Family TRADD, N-terminal domain 0.014
Further Details:      
 
Domain Number - Region: 352-379
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0301
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243232.MJ1650
Sequence length 384
Comment (Methanococcus jannaschii)
Sequence
MIMVNLRIINFIGDIMKIRGICYRCGAEDELIDGLCPICYAQEHPLIEVPDRVEIEVCHM
CGSYKRKIWQTPKSEEAFEILNEIAYYATKDAIKKKSVMVEVEIYPEVTQLPGGKRSKLI
IPVHIVARGRLPGEKEDRTYEKDIEVHLRMVQCPRCSRFMSNYYEATLQVRAMNRYLTEE
EREELDNFVREELAKRLKKDRMAFIAKFIPQKEGLDYQLGSVGAARNVAQRIKEKYGGKI
TETATLVGVDRDSGKELYRVTVSVRVPEYKVGDVVEYKDKYYLVTAITEDKVYMKSIDYK
REKIGLAWHIAEKETKMAKKKDELDTATVIATTPTIMVMDDKSYEVYEFDNIGDVKIKEG
DKVKIFKKEGVSYLVNKIEGKDKQ
Download sequence
Identical sequences Q59044
243232.MJ1650 359372 MjR78 gi|15669846|ref|NP_248660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]