SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243233.MCA3111 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  243233.MCA3111
Domain Number - Region: 105-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000562
Family NfeD domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243233.MCA3111
Sequence length 147
Comment (Methylococcus capsulatus Bath)
Sequence
MTGFSLVFWHWWTLGALLLILELLLPGMYFLWMAEAALLTGAVLWLLPGLGWEIQLLVFS
VLSLASIFVFEKFIGRKPIVSDRPLLNRRAAQYIGRTLMLEQPIVNGMGKIRIDDSIWRV
HGDDCPAGTKIRVCDVDGVILKVERVA
Download sequence
Identical sequences Q602F2
WP_010962295.1.29143 243233.MCA3111 gi|53802721|ref|YP_115498.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]