SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243243.MAV_0282 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243243.MAV_0282
Domain Number 1 Region: 14-63
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000714
Family Terminase gpNU1 subunit domain 0.071
Further Details:      
 
Domain Number 2 Region: 81-150
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000263
Family ABC transporter ATPase domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243243.MAV_0282
Sequence length 155
Comment (Mycobacterium avium 104)
Sequence
MTTTTTTRIRIGTPAVAERLGVSDETIRQEIKRGNLPAIRVGRTYRVLESDVDEYIAAAE
AEAYSARKRKVGVEVTSGESEAGAEVRISGPSGSGKSSLVRELRGLWGDAVTAHRYSDDG
SEVLRLSTIDVEPSIADVAENDGLPPRFHLANLNA
Download sequence
Identical sequences A0A0H2ZVB4
WP_011723452.1.17321 WP_011723452.1.35384 gi|118463555|ref|YP_879571.1| 243243.MAV_0282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]