SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243243.MAV_1062 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243243.MAV_1062
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000053
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243243.MAV_1062
Sequence length 232
Comment (Mycobacterium avium 104)
Sequence
MLTVDGVLDPASSTLLRDRIIKATLDQTPAVVIDVSALKVNAESTWSTFMATYWQLGNTP
HVPLVLVCAKKAAREAIARSGITHFMPVYSSQKAALKALGPNSRRIVRRADAQLPADLTS
LRESRRLVREWLTTWSQSKLIPVALVVVNVFVENVLEHTASVPVMRVEAQGTTATIAVSD
ASNTPAVRLPSPVKGIDVSGLAIVDALSRAWGSTPTASGKTVWAIIGPENQL
Download sequence
Identical sequences A0A0H2ZS77 X7V6D9
gi|118462473|ref|YP_880317.1| 243243.MAV_1062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]