SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243243.MAV_3096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243243.MAV_3096
Domain Number 1 Region: 113-367
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.59e-64
Family D-glucarate dehydratase-like 0.00047
Further Details:      
 
Domain Number 2 Region: 7-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.08e-28
Family Enolase N-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243243.MAV_3096
Sequence length 368
Comment (Mycobacterium avium 104)
Sequence
MTPDPAIDEVTARVYQIPTDAPEADGTLSWSSTTLVLAEVAAGGRRGIGYTYADGACAAL
ITGALAGSVTGHSALDVPARWQAMVRAMRNNGRPGLVSCAISAVDTALWDLKGKLLGLPV
CRLLGMAHDSVPIYGSGGFTSYDDNATRAQLERWVHEWRIPRVKIKIGESWGSHERRDLD
RIALARTVIGPDTELYVDANGGYRRKQAIRMAHAMAGHDVTWFEEPVSSDDLAGLREVRD
QVSADVTAGEYGYDLAYFHRMLAADAVDCLQIDVTRCGGITDWLRAAAVAAAHNVDVSGH
CAPNLHAHVATAVANLRHLEYFHDHHRIERMFFDGALSPQGGVLRPDQQRPGFGLEFKQR
DADRYRMR
Download sequence
Identical sequences A0A0H2ZTB4 A0A1X0BSF6 X8B2N1
gi|118463401|ref|YP_882280.1| WP_011725249.1.100504 WP_011725249.1.14691 WP_011725249.1.14707 WP_011725249.1.15384 WP_011725249.1.17266 WP_011725249.1.17321 WP_011725249.1.17624 WP_011725249.1.35384 WP_011725249.1.35510 WP_011725249.1.44666 WP_011725249.1.54538 WP_011725249.1.65674 WP_011725249.1.70933 WP_011725249.1.75695 WP_011725249.1.87736 WP_011725249.1.94747 243243.MAV_3096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]