SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243243.MAV_3291 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243243.MAV_3291
Domain Number 1 Region: 79-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000392
Family NfeD domain-like 0.0058
Further Details:      
 
Weak hits

Sequence:  243243.MAV_3291
Domain Number - Region: 21-71
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00353
Family LacY-like proton/sugar symporter 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243243.MAV_3291
Sequence length 145
Comment (Mycobacterium avium 104)
Sequence
MHAAVLWLIFALVLAGAEALTGHLFLVMLGGGALAAALTSWLTDFPAWLNGTVFLVVSVL
LLVVVRPPLRRRLTPAAVPQLGIEALEGKTALVLERVARDRGQVKLDGQVWTARPLDEND
VYEPGEPVTVMQIDGATAVVFKSSL
Download sequence
Identical sequences A0A0E2W585 A0A0H2ZW15 A0A2A2ZGL5 V7J8Z2 V7KCK8 V7L0W4 V7LEU5 V7NZB5 X8B9E8
gi|118464558|ref|YP_882473.1| 243243.MAV_3291 WP_009977542.1.14373 WP_009977542.1.14691 WP_009977542.1.1472 WP_009977542.1.17266 WP_009977542.1.17321 WP_009977542.1.17624 WP_009977542.1.20882 WP_009977542.1.32203 WP_009977542.1.35384 WP_009977542.1.39409 WP_009977542.1.44666 WP_009977542.1.49379 WP_009977542.1.56924 WP_009977542.1.62105 WP_009977542.1.65674 WP_009977542.1.67285 WP_009977542.1.70933 WP_009977542.1.7097 WP_009977542.1.72172 WP_009977542.1.74957 WP_009977542.1.75695 WP_009977542.1.84212 WP_009977542.1.88567 WP_009977542.1.93735 WP_009977542.1.93753 WP_009977542.1.94747 WP_009977542.1.99050 WP_009977542.1.9971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]