SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243265.plu3070 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243265.plu3070
Domain Number 1 Region: 108-306
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.57e-47
Family D-glucarate dehydratase-like 0.000000125
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.71e-28
Family Enolase N-terminal domain-like 0.0000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243265.plu3070
Sequence length 323
Comment (Photorhabdus luminescens)
Sequence
MRTATLYRFRLPMEAGVILRYQRLKTRDGFLVHLQENGQQGWGEIAPLPEFSKETVEQAG
EAAVAWLRLWHLGAEPDESELPSVAFGISCALAELQGNLPEEADYRKAPLCNGDPDELIV
RLNNMSGQKVAKVKIGLYEAVRDGMVVNVLLEAVPDLSLRLDANRSWSRAKADSFAKYVN
PDYRNRIAFLEEPCQTSQQSLAFARDTGIAIAWDESVRDEGFNVEAQAGVTAIVIKPTLT
GSLARCCQLISAAHNVGLEAVISSSIETSFGLTQLARIAHWLTPATIPGLDTLELIQSQL
VRRWPGSTMPVTRLDELAIAWRS
Download sequence
Identical sequences Q7N2K6
243265.plu3070 gi|37526958|ref|NP_930302.1| WP_011147287.1.100813 WP_011147287.1.49830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]