SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243265.plu4043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243265.plu4043
Domain Number 1 Region: 9-155
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 2.62e-39
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243265.plu4043
Sequence length 155
Comment (Photorhabdus luminescens)
Sequence
MNNQADLLLSSVLSLACTRNNVHCSSKKRALEIISELASQQLKLPENVVFEAILTREKVG
TTGIGSGIAIPHGKLDEESSDQAVGVFLNLEQPIAFDAIDNQPVDLLFALLVPNDQCQTH
LHTLSLIAKRLADKNLCRRLRSAQSDEELYTIITE
Download sequence
Identical sequences Q7N054
WP_011148172.1.100813 WP_011148172.1.49830 gi|37527895|ref|NP_931240.1| 243265.plu4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]