SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243275.TDE0949 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243275.TDE0949
Domain Number 1 Region: 139-430
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.26e-127
Family Enolase 0.0000000252
Further Details:      
 
Domain Number 2 Region: 4-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.7e-57
Family Enolase N-terminal domain-like 0.0000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243275.TDE0949
Sequence length 433
Comment (Treponema denticola ATCC 35405)
Sequence
MSDIIYIEGREILDSRGNPTVEVEVQLSDFSYGRACVPSGASTGEYEALEMRDGDKSRYM
GKGVLKAVDQVNTVIAEELDGADALDQAEIDNMLINLDGTENKSKLGANAMLGVSMAVAR
AAADSLGLPLYRYLGGVHAMQMPVPMANIINGGRHSDNKIDFQEYMIMPVGAPSIREGIR
MTAEVFHALKDILKKEGHVTAVGDEGGFAPNIENVQALDYIMKAIEKAGYKPGKDVVIAL
DCASSELFDAGDRKGYKFWKSEPSKILNADEMVDLFKDWISKYPIVSIEDPLDQNDWEGY
AKMTKELGNQIQIVGDDFFVTNTKRLARGIEEGACNSILIKLNQIGTVTETIDAVRMAQK
AGYTAVISHRSGETEDAFIADLAVALETGQIKTGSMSRSDRIAKYNQLMRIEDELGYNAR
YAGMATFANLIKK
Download sequence
Identical sequences M2C9E6 Q73P50 S3KJI6
NP_971559.1.36654 WP_002682247.1.14699 WP_002682247.1.22144 WP_002682247.1.62554 WP_002682247.1.94299 WP_002682247.1.96686 gi|42526461|ref|NP_971559.1| 243275.TDE0949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]