SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243275.TDE1505 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243275.TDE1505
Domain Number 1 Region: 101-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000157
Family NfeD domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243275.TDE1505
Sequence length 147
Comment (Treponema denticola ATCC 35405)
Sequence
MGWWSIWLLVGVLCIGLELIIPGLVIIFFGFGAVFTSVFSLIPFINQALWLQIIIFVIFS
VLSLAFLRKKFTPIFKGTIFYSDKKSDKEGEEFADVIETVFHNKEGRIKYQGTTWSARSL
SEEIPAGSMVRVLRREGLTYIVEKAEK
Download sequence
Identical sequences A0A0E2ESE7 M2BZQ2 Q73MK3
NP_972111.1.36654 WP_002671223.1.22144 WP_002671223.1.77811 WP_002671223.1.77933 WP_002671223.1.94299 243275.TDE1505 gi|42527013|ref|NP_972111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]