SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243275.TDE2235 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243275.TDE2235
Domain Number 1 Region: 162-411
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.57e-84
Family D-glucarate dehydratase-like 0.0000000497
Further Details:      
 
Domain Number 2 Region: 1-159
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.42e-63
Family Enolase N-terminal domain-like 0.000000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243275.TDE2235
Sequence length 412
Comment (Treponema denticola ATCC 35405)
Sequence
MKIVDVVCAEGKTGFYFDDQKAIKMGAGHDGFFYTGKPVTEGFTSIRQAGEAISVMFILE
DGQVAYGDCAAVQYSGAGGRDPLFLAKDFIPVIEKDIKPLFVGKEITNFREMAKTFEEHK
VNGKRMHTALRYGISQAILDAVAKSQHITMAEVVVKEYNTGCQIKRIPIFTQSGDDRYLN
ADKMIIKQAEVLPHGLFNNVEEKTGKNGEKLLEYVKWLKNRVETMRTCKNYNPIFHIDVY
GTIGDFTNNDVPKMTAYLKTLESAAAPFKLRIEGPMDMGDREKQMQVLAALTKSLDDNGV
KVELVADEWCNTLEDIQYFADNRAGHMIQIKTPDLGGINNTIEAILYCKEKGVGAYCGGT
CNETNRSAEVIVNCSVAAGAAQQLAKPGMGVDEGYMIINNEMNRIVALANRK
Download sequence
Identical sequences M2CBA4 Q73KI3
gi|42527737|ref|NP_972835.1| 243275.TDE2235 NP_972835.1.36654 WP_002680089.1.22144 WP_002680089.1.94299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]