SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243277.VCA1097 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243277.VCA1097
Domain Number 1 Region: 13-97
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000314
Family Anti-sigma factor antagonist SpoIIaa 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243277.VCA1097
Sequence length 101
Comment (Vibrio cholerae)
Sequence
MTIHFILKVWISMLILNEVLDIAHVQECKQQLLPWMSQEAPIVIDGSAVARVDAAGVQLL
ASLFITAQHNGQQIHFEQLSDVLAEGLALLGMADLMQLKSE
Download sequence
Identical sequences A0A0H3AEX8 A0A0H3Q396 A0A0H5VXK2 A0A0X1L1H4 C3LX08 Q9KKK7
gi|227812660|ref|YP_002812670.1| gi|15601846|ref|NP_233477.1| gi|147672012|ref|YP_001214987.1| gi|147672012|ref|YP_001214987.1| NP_233477.1.72393 WP_001882872.1.100264 WP_001882872.1.100388 WP_001882872.1.100440 WP_001882872.1.10071 WP_001882872.1.100976 WP_001882872.1.101117 WP_001882872.1.10121 WP_001882872.1.101220 WP_001882872.1.101314 WP_001882872.1.101507 WP_001882872.1.101933 WP_001882872.1.102054 WP_001882872.1.1024 WP_001882872.1.10626 WP_001882872.1.10834 WP_001882872.1.10887 WP_001882872.1.11270 WP_001882872.1.11351 WP_001882872.1.11879 WP_001882872.1.11885 WP_001882872.1.11965 WP_001882872.1.12252 WP_001882872.1.12262 WP_001882872.1.12332 WP_001882872.1.12525 WP_001882872.1.12527 WP_001882872.1.12548 WP_001882872.1.12590 WP_001882872.1.12686 WP_001882872.1.13053 WP_001882872.1.13155 WP_001882872.1.13156 WP_001882872.1.13395 WP_001882872.1.13454 WP_001882872.1.13652 WP_001882872.1.13725 WP_001882872.1.14080 WP_001882872.1.14179 WP_001882872.1.14257 WP_001882872.1.14263 WP_001882872.1.14353 WP_001882872.1.14904 WP_001882872.1.14995 WP_001882872.1.15109 WP_001882872.1.15134 WP_001882872.1.15179 WP_001882872.1.15200 WP_001882872.1.15516 WP_001882872.1.15786 WP_001882872.1.15997 WP_001882872.1.16351 WP_001882872.1.16382 WP_001882872.1.17232 WP_001882872.1.17295 WP_001882872.1.17621 WP_001882872.1.17738 WP_001882872.1.18375 WP_001882872.1.18392 WP_001882872.1.18447 WP_001882872.1.18484 WP_001882872.1.18577 WP_001882872.1.18862 WP_001882872.1.18916 WP_001882872.1.19126 WP_001882872.1.19128 WP_001882872.1.19428 WP_001882872.1.19442 WP_001882872.1.19503 WP_001882872.1.19597 WP_001882872.1.20065 WP_001882872.1.20107 WP_001882872.1.20336 WP_001882872.1.20379 WP_001882872.1.20404 WP_001882872.1.20602 WP_001882872.1.20669 WP_001882872.1.20699 WP_001882872.1.20758 WP_001882872.1.21073 WP_001882872.1.21179 WP_001882872.1.21281 WP_001882872.1.21558 WP_001882872.1.21671 WP_001882872.1.21717 WP_001882872.1.21764 WP_001882872.1.21815 WP_001882872.1.21866 WP_001882872.1.22521 WP_001882872.1.22773 WP_001882872.1.229 WP_001882872.1.22953 WP_001882872.1.2304 WP_001882872.1.23134 WP_001882872.1.2316 WP_001882872.1.23333 WP_001882872.1.23361 WP_001882872.1.2341 WP_001882872.1.23416 WP_001882872.1.23424 WP_001882872.1.23538 WP_001882872.1.2354 WP_001882872.1.23808 WP_001882872.1.23955 WP_001882872.1.240 WP_001882872.1.2401 WP_001882872.1.24106 WP_001882872.1.24280 WP_001882872.1.24345 WP_001882872.1.24399 WP_001882872.1.2496 WP_001882872.1.24980 WP_001882872.1.25649 WP_001882872.1.26020 WP_001882872.1.26156 WP_001882872.1.26223 WP_001882872.1.2627 WP_001882872.1.26326 WP_001882872.1.26508 WP_001882872.1.26580 WP_001882872.1.27186 WP_001882872.1.27435 WP_001882872.1.27458 WP_001882872.1.27639 WP_001882872.1.27863 WP_001882872.1.28431 WP_001882872.1.2849 WP_001882872.1.28508 WP_001882872.1.29095 WP_001882872.1.29535 WP_001882872.1.29708 WP_001882872.1.29889 WP_001882872.1.30107 WP_001882872.1.30292 WP_001882872.1.3032 WP_001882872.1.30360 WP_001882872.1.3054 WP_001882872.1.30927 WP_001882872.1.31096 WP_001882872.1.31718 WP_001882872.1.31964 WP_001882872.1.32264 WP_001882872.1.32271 WP_001882872.1.32814 WP_001882872.1.32942 WP_001882872.1.32955 WP_001882872.1.33019 WP_001882872.1.33093 WP_001882872.1.33625 WP_001882872.1.33811 WP_001882872.1.33819 WP_001882872.1.34108 WP_001882872.1.34195 WP_001882872.1.34261 WP_001882872.1.34634 WP_001882872.1.34643 WP_001882872.1.3514 WP_001882872.1.35201 WP_001882872.1.35266 WP_001882872.1.35630 WP_001882872.1.35880 WP_001882872.1.35881 WP_001882872.1.36322 WP_001882872.1.3635 WP_001882872.1.36354 WP_001882872.1.36441 WP_001882872.1.36513 WP_001882872.1.36668 WP_001882872.1.36686 WP_001882872.1.36874 WP_001882872.1.36973 WP_001882872.1.37054 WP_001882872.1.37260 WP_001882872.1.37262 WP_001882872.1.37537 WP_001882872.1.37676 WP_001882872.1.37784 WP_001882872.1.37999 WP_001882872.1.38420 WP_001882872.1.38590 WP_001882872.1.39514 WP_001882872.1.39675 WP_001882872.1.39853 WP_001882872.1.39933 WP_001882872.1.40039 WP_001882872.1.40152 WP_001882872.1.40346 WP_001882872.1.40433 WP_001882872.1.40459 WP_001882872.1.40470 WP_001882872.1.40484 WP_001882872.1.40491 WP_001882872.1.40542 WP_001882872.1.40571 WP_001882872.1.40740 WP_001882872.1.40782 WP_001882872.1.41573 WP_001882872.1.4175 WP_001882872.1.42128 WP_001882872.1.42152 WP_001882872.1.42498 WP_001882872.1.42617 WP_001882872.1.4272 WP_001882872.1.42783 WP_001882872.1.4284 WP_001882872.1.42853 WP_001882872.1.42865 WP_001882872.1.42885 WP_001882872.1.43103 WP_001882872.1.43335 WP_001882872.1.43407 WP_001882872.1.4365 WP_001882872.1.43884 WP_001882872.1.439 WP_001882872.1.44569 WP_001882872.1.44709 WP_001882872.1.44730 WP_001882872.1.45055 WP_001882872.1.45127 WP_001882872.1.45155 WP_001882872.1.45206 WP_001882872.1.45264 WP_001882872.1.45372 WP_001882872.1.45704 WP_001882872.1.45842 WP_001882872.1.45903 WP_001882872.1.45958 WP_001882872.1.46118 WP_001882872.1.46146 WP_001882872.1.46540 WP_001882872.1.4661 WP_001882872.1.4701 WP_001882872.1.47202 WP_001882872.1.4730 WP_001882872.1.4731 WP_001882872.1.47417 WP_001882872.1.47428 WP_001882872.1.47736 WP_001882872.1.47794 WP_001882872.1.47796 WP_001882872.1.47846 WP_001882872.1.47942 WP_001882872.1.48128 WP_001882872.1.48305 WP_001882872.1.48659 WP_001882872.1.48715 WP_001882872.1.488 WP_001882872.1.48927 WP_001882872.1.48984 WP_001882872.1.49238 WP_001882872.1.49317 WP_001882872.1.50254 WP_001882872.1.50277 WP_001882872.1.50577 WP_001882872.1.50625 WP_001882872.1.50813 WP_001882872.1.50822 WP_001882872.1.50980 WP_001882872.1.51160 WP_001882872.1.51177 WP_001882872.1.51661 WP_001882872.1.5201 WP_001882872.1.52391 WP_001882872.1.52676 WP_001882872.1.53085 WP_001882872.1.5320 WP_001882872.1.53214 WP_001882872.1.5397 WP_001882872.1.54191 WP_001882872.1.5425 WP_001882872.1.54398 WP_001882872.1.5450 WP_001882872.1.54706 WP_001882872.1.54901 WP_001882872.1.55092 WP_001882872.1.55665 WP_001882872.1.55929 WP_001882872.1.55932 WP_001882872.1.56429 WP_001882872.1.56785 WP_001882872.1.56807 WP_001882872.1.57098 WP_001882872.1.57148 WP_001882872.1.57300 WP_001882872.1.57518 WP_001882872.1.57546 WP_001882872.1.57678 WP_001882872.1.57751 WP_001882872.1.57945 WP_001882872.1.58295 WP_001882872.1.58367 WP_001882872.1.58596 WP_001882872.1.58844 WP_001882872.1.58975 WP_001882872.1.59010 WP_001882872.1.59194 WP_001882872.1.59378 WP_001882872.1.59394 WP_001882872.1.5943 WP_001882872.1.59554 WP_001882872.1.59633 WP_001882872.1.59741 WP_001882872.1.59916 WP_001882872.1.60216 WP_001882872.1.60386 WP_001882872.1.60633 WP_001882872.1.60694 WP_001882872.1.60800 WP_001882872.1.60955 WP_001882872.1.61169 WP_001882872.1.61523 WP_001882872.1.61624 WP_001882872.1.61644 WP_001882872.1.61753 WP_001882872.1.61869 WP_001882872.1.61875 WP_001882872.1.61935 WP_001882872.1.62165 WP_001882872.1.62324 WP_001882872.1.62425 WP_001882872.1.63347 WP_001882872.1.63546 WP_001882872.1.63655 WP_001882872.1.6366 WP_001882872.1.63723 WP_001882872.1.63749 WP_001882872.1.63779 WP_001882872.1.63911 WP_001882872.1.64201 WP_001882872.1.64253 WP_001882872.1.64315 WP_001882872.1.64382 WP_001882872.1.64441 WP_001882872.1.65007 WP_001882872.1.65051 WP_001882872.1.65086 WP_001882872.1.65528 WP_001882872.1.66329 WP_001882872.1.66633 WP_001882872.1.66696 WP_001882872.1.67616 WP_001882872.1.67770 WP_001882872.1.67839 WP_001882872.1.68424 WP_001882872.1.68506 WP_001882872.1.68723 WP_001882872.1.68863 WP_001882872.1.68925 WP_001882872.1.69049 WP_001882872.1.69085 WP_001882872.1.69157 WP_001882872.1.69843 WP_001882872.1.69857 WP_001882872.1.70069 WP_001882872.1.70176 WP_001882872.1.70247 WP_001882872.1.7049 WP_001882872.1.70775 WP_001882872.1.70813 WP_001882872.1.70892 WP_001882872.1.71129 WP_001882872.1.72106 WP_001882872.1.72241 WP_001882872.1.72326 WP_001882872.1.72361 WP_001882872.1.72369 WP_001882872.1.7238 WP_001882872.1.72480 WP_001882872.1.72856 WP_001882872.1.73148 WP_001882872.1.73429 WP_001882872.1.73555 WP_001882872.1.73855 WP_001882872.1.73929 WP_001882872.1.74111 WP_001882872.1.74503 WP_001882872.1.74666 WP_001882872.1.74991 WP_001882872.1.75012 WP_001882872.1.75326 WP_001882872.1.75378 WP_001882872.1.75778 WP_001882872.1.75796 WP_001882872.1.76320 WP_001882872.1.76425 WP_001882872.1.76486 WP_001882872.1.7654 WP_001882872.1.76645 WP_001882872.1.77029 WP_001882872.1.7717 WP_001882872.1.77355 WP_001882872.1.77397 WP_001882872.1.77445 WP_001882872.1.77703 WP_001882872.1.77794 WP_001882872.1.77830 WP_001882872.1.77914 WP_001882872.1.78157 WP_001882872.1.78172 WP_001882872.1.78428 WP_001882872.1.78531 WP_001882872.1.79044 WP_001882872.1.79776 WP_001882872.1.79943 WP_001882872.1.80024 WP_001882872.1.8023 WP_001882872.1.80339 WP_001882872.1.80500 WP_001882872.1.80618 WP_001882872.1.80628 WP_001882872.1.80702 WP_001882872.1.80744 WP_001882872.1.80808 WP_001882872.1.8117 WP_001882872.1.81871 WP_001882872.1.81917 WP_001882872.1.82119 WP_001882872.1.82193 WP_001882872.1.82248 WP_001882872.1.82262 WP_001882872.1.82413 WP_001882872.1.82583 WP_001882872.1.83040 WP_001882872.1.83073 WP_001882872.1.83082 WP_001882872.1.83109 WP_001882872.1.83703 WP_001882872.1.83761 WP_001882872.1.84385 WP_001882872.1.84519 WP_001882872.1.84610 WP_001882872.1.8480 WP_001882872.1.85007 WP_001882872.1.85086 WP_001882872.1.85498 WP_001882872.1.85822 WP_001882872.1.85878 WP_001882872.1.85961 WP_001882872.1.85972 WP_001882872.1.85998 WP_001882872.1.86057 WP_001882872.1.86192 WP_001882872.1.86269 WP_001882872.1.86874 WP_001882872.1.86879 WP_001882872.1.87274 WP_001882872.1.87286 WP_001882872.1.87335 WP_001882872.1.87355 WP_001882872.1.87573 WP_001882872.1.87602 WP_001882872.1.87804 WP_001882872.1.88057 WP_001882872.1.88230 WP_001882872.1.88283 WP_001882872.1.88350 WP_001882872.1.88556 WP_001882872.1.8867 WP_001882872.1.89144 WP_001882872.1.89441 WP_001882872.1.89719 WP_001882872.1.89822 WP_001882872.1.89889 WP_001882872.1.8997 WP_001882872.1.89995 WP_001882872.1.90120 WP_001882872.1.90133 WP_001882872.1.90227 WP_001882872.1.90437 WP_001882872.1.90675 WP_001882872.1.90774 WP_001882872.1.90889 WP_001882872.1.91247 WP_001882872.1.91262 WP_001882872.1.91274 WP_001882872.1.91539 WP_001882872.1.91747 WP_001882872.1.91794 WP_001882872.1.91841 WP_001882872.1.92038 WP_001882872.1.92063 WP_001882872.1.92069 WP_001882872.1.92157 WP_001882872.1.92401 WP_001882872.1.92516 WP_001882872.1.92559 WP_001882872.1.92632 WP_001882872.1.92696 WP_001882872.1.92703 WP_001882872.1.92952 WP_001882872.1.92993 WP_001882872.1.9302 WP_001882872.1.93060 WP_001882872.1.93399 WP_001882872.1.93441 WP_001882872.1.93836 WP_001882872.1.93945 WP_001882872.1.94255 WP_001882872.1.94426 WP_001882872.1.94441 WP_001882872.1.94481 WP_001882872.1.94827 WP_001882872.1.94887 WP_001882872.1.95516 WP_001882872.1.95549 WP_001882872.1.9561 WP_001882872.1.95662 WP_001882872.1.95733 WP_001882872.1.95976 WP_001882872.1.96001 WP_001882872.1.9607 WP_001882872.1.96089 WP_001882872.1.96187 WP_001882872.1.96311 WP_001882872.1.96471 WP_001882872.1.9660 WP_001882872.1.96687 WP_001882872.1.96693 WP_001882872.1.96704 WP_001882872.1.96980 WP_001882872.1.97100 WP_001882872.1.97144 WP_001882872.1.97288 WP_001882872.1.97516 WP_001882872.1.97552 WP_001882872.1.97650 WP_001882872.1.97799 WP_001882872.1.97832 WP_001882872.1.9787 WP_001882872.1.98021 WP_001882872.1.98116 WP_001882872.1.98172 WP_001882872.1.98246 WP_001882872.1.98280 WP_001882872.1.98373 WP_001882872.1.98624 WP_001882872.1.98642 WP_001882872.1.99128 WP_001882872.1.99204 WP_001882872.1.99417 WP_001882872.1.99452 WP_001882872.1.995 WP_001882872.1.99872 WP_001882872.1.99949 WP_001882872.1.99992 243277.VCA1097 345073.VC0395_0146 579112.VCM66_A1054 593588.VCD_000246 gi|229605306|ref|YP_002876010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]