SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243365.CV_0303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243365.CV_0303
Domain Number 1 Region: 724-968
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.89e-32
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.01
Further Details:      
 
Domain Number 2 Region: 19-201
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.35e-19
Family PFOR Pyr module 0.067
Further Details:      
 
Domain Number 3 Region: 439-626
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000925
Family Pyruvate oxidase and decarboxylase PP module 0.023
Further Details:      
 
Domain Number 4 Region: 268-402
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000262
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.043
Further Details:      
 
Weak hits

Sequence:  243365.CV_0303
Domain Number - Region: 618-693
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0515
Family Short-chain ferredoxins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243365.CV_0303
Sequence length 1161
Comment (Chromobacterium violaceum)
Sequence
MSIRHADLEEKYTAPTGQVLMTGIQALVRLPMLQQELDRAAGLNTAGYVTGYRGSPLGNV
DQTMLKAKKHLDAHNVVFHPGLNEDLAATAVWGTQQVNIFEGAKYDGVYSLWYGKGPGVD
RSGDVLKHGNAAGTSKHGGVLLVCGDDHAAKSSTFPHQSDHILAASMIPVLSPSGVQEVL
DLGLHGWAMSRYSGCWVSIKAITDTIESSAIVDITPERLEFKIPQDFPLPDDGLNIRWPD
TPLAQEKRVLHHRLYAALAYARENKLNRITLDSPKPRLGIITCGKSYLDVMQALDDLGIS
EAQAADIGLRIFKVGMVWPLEPEGVRQFAQGLEEILVVEEKRQIIEYQLKEQLYNWRDDI
RPRVVGKFAEKGEWALPHGDWLLPAAGELTPAMIARAIASRLALIFDSPVIHDRLKFYED
KEAQLVQPRESIARVPHYCSGCPHNTSTKLPEGSRAVAGIGCHYMAHWISPETTKTFTQM
GGEGITWLGQAPFTTTKHIFTNLGDGTYFHSGILAIRAAVAGKVNITYKILYNDAVAMTG
GQHVDGYLDVPMMTRQLAAEGVKRIVITSDDPDKYQNAQGLAPGIDVFHRRELDRVQREL
RDIEGVTILIHDQTCAAEKRRRRKRGEFPDPAKRAFINERVCEGCGDCSKKSGCLSVLPV
ETPLGRKRKIDQSSCNKDYSCVEGFCPSFVTVEGGKLRKPAGASADLAKMPALPAPKIPA
LHEPFGIMVTGVGGTGVVTIGQVLGMAAYLDNKGVTVLDMAGLAQKGGSVWSHVRIADSQ
DKLHAVRIAAGDANLVLGCDLVVTAAEEALAKMREGFSHAIVNNYESPTSGFLKNPDLRF
PAKAMKDAIVEAVGAGLFNEVNATRLATSLMGDAIAANMFMLGYAWQKGLVPVTLEAIME
AVRLNGAAVKFNQDAFTWGRHAAQDLARVEALVSPTAVVAFVPRETPDAVVHHRATLLAA
YQNAKLAERYKALVQQVRQAEEAAQPGSTALTLAAARAYHHLLAYKDEYEVARLYSDGEF
QREVAAQFDGDYKLRFHIGVAWLTGGKPRKIAFGPWLMPAMKMLAKLRFLRGTALDPFAW
QDDRKLERRLIAEFERELPALLAKLSPDALPRTVEWVKTWEGVRGFGHIKTANYRQAKAR
QAELMGGAAQAGKPAASAAVA
Download sequence
Identical sequences Q7P1B0
243365.CV_0303 gi|34495758|ref|NP_899973.1| WP_011133858.1.48671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]