SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243365.CV_2511 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243365.CV_2511
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000196
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243365.CV_2511
Sequence length 106
Comment (Chromobacterium violaceum)
Sequence
MGLQLRQDGETTLAALDGELTIFTAEDMQDELLGLLNHERVALDLSGLTELDGCGAQLLC
ILLAEAARLEKTMAIAAGNPLLDEVGGWMGLAPKAGGGQGEAGDGS
Download sequence
Identical sequences Q7NV35
WP_011136058.1.48671 243365.CV_2511 gi|34497966|ref|NP_902181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]