SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246194.CHY_0045 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246194.CHY_0045
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.15e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246194.CHY_0045
Sequence length 187
Comment (Carboxydothermus hydrogenoformans Z-2901)
Sequence
MAKVVKIALAGEGGQGVQSVAEIIAEAANEEGKEAIYIPNFGVEQRGGVSIAFIQISDEP
IGSPKFEKGDIVVALSDRAIRRTRQYVGENTIFVYDSSIEGVEQDLPTNAKKILAIPALE
IAKKELHPRVFNVVIMGAVLEATGVVTMEQAKKAIEKKLGYKFEKDPKLRELNYKAIDRG
ASLVREQ
Download sequence
Identical sequences Q3AG17
gi|78043393|ref|YP_358917.1| 246194.CHY_0045 WP_011342993.1.931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]