SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246194.CHY_0122 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246194.CHY_0122
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.15e-41
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246194.CHY_0122
Sequence length 187
Comment (Carboxydothermus hydrogenoformans Z-2901)
Sequence
MDKNILLAGVGGQGTILASKIIAGVAEKAGLDVKVAEVHGMAQRGGAVVTYLRFGKKVNS
PLIAHREADFLLAFEKLEALRWLSYLKPEGLALVNDMEIYPLPVLTGKASYPDFRERAQG
VNFNLIPAREIAKSRNNPRGINMVLLGFLAKRLTFPKEAWLQEIQKRSGKFSEANIACFQ
AGFTYGA
Download sequence
Identical sequences Q3AFU0
gi|78044852|ref|YP_358994.1| WP_011343070.1.88130 WP_011343070.1.931 246194.CHY_0122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]