SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246194.CHY_0284 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246194.CHY_0284
Domain Number 1 Region: 138-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.99e-136
Family Enolase 0.00000000965
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-60
Family Enolase N-terminal domain-like 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 246194.CHY_0284
Sequence length 428
Comment (Carboxydothermus hydrogenoformans Z-2901)
Sequence
MSEIREVIAREILDSRGNPTVEVDVILEDGTWGRAAVPSGASTGAFEAVELRDNDPQRYL
GKGVTQAVENVNSIIGPEILGFDALDQVGIDEYLIELDGTPNKGKLGANAILGVSMAVAK
AAANYLGLPLYRYLGGTNARVLPAPMMNILNGGKHADNNVDIQEFMIMPLGASSFSEALR
MGAEVFHNLKKVLKGKGYNTAVGDEGGFAPNLKSNEEAIEVIVEAIEKAGYTPGKDIYIA
LDVAATELYKDGFYVLEGEGVKKSAAEMVEYYEKLCAKYPIISIEDGMSEEDWDGWKLLT
ERLGKKIQLVGDDLFVTNVERLQKGIDLGVANSILIKLNQIGTITETLNTIELARQNGYT
TIISHRSGETEDTTLADLAVAVNAGMIKTGAPSRTDRVAKYNQLLRIEEELDYTAIYKGL
KAFYNIKA
Download sequence
Identical sequences Q3AFC8
gi|78042740|ref|YP_359156.1| WP_011343232.1.88130 WP_011343232.1.931 246194.CHY_0284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]