SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246194.CHY_0856 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246194.CHY_0856
Domain Number 1 Region: 11-188
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.08e-26
Family Clp protease, ClpP subunit 0.04
Further Details:      
 
Domain Number 2 Region: 359-428
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000301
Family NfeD domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246194.CHY_0856
Sequence length 430
Comment (Carboxydothermus hydrogenoformans Z-2901)
Sequence
MGKFRGKIIFWLMVFLWLTTPVYAGVLATRVEGVIDPVIAGHLKEIIQKAEREEASFVLI
ELNTPGGLDTSMREITSAILAAKVPVGVWVGPSGARAASAGTFILYSAQVAAMAPQTTIG
SAHPVNLGGQSLDQDLRAKVENDAVSYITSLAKRNGRNPVWAEEAVRKSVSVDAEEAYKK
GIINFIAKNPEEFLEKAHGLRVKVSGSELVLNLKGQRIKYLDLSLWEKFLHALANPELAY
FLILVGIYGLIYEFAHPGGMVGGITGVLALLMAFYSLSVLPTTLTGLLLLLFGLALIIAE
LYLPTFGALGVGGVISITLGSLFLFGTDLPGLTISWVNILPLVLLLALGVYLLIKLAVRA
QKSKSLTGMEGMIGLTGKVTADLQPEGFVMVRGEIWKAKAVEGKTIPRGTPVKVIGVNGL
TLVVDEVNES
Download sequence
Identical sequences Q3ADS7
gi|78044964|ref|YP_359707.1| WP_011343783.1.931 246194.CHY_0856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]