SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246195.DNO_0855 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246195.DNO_0855
Domain Number 1 Region: 15-93
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000128
Family Anti-sigma factor antagonist SpoIIaa 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 246195.DNO_0855
Sequence length 102
Comment (Dichelobacter nodosus VCS1703A)
Sequence
MIETPLGTIDADAVLHLSATLTQLSLAQKPFSRFSQALPERITVDAHAVRQCDSAGVAAL
IWWCRYCRQQNAHLVWRPLPASITELAALYQIDFQAWTEYAD
Download sequence
Identical sequences A5EYC0
246195.DNO_0855 WP_012031176.1.19569 WP_012031176.1.91152 gi|146329837|ref|YP_001209752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]